Keep my session open?
Ending In 
The session is expired
Vaša relácia uplynula. Pre Vašu bezpečnosť sme Vás odhlásili.
Chcete sa opäť prihlásiť?

Anti-SPAG5 Mouse Monoclonal Antibody [clone: 5F9]

Dodávateľ: US Biological
Type: Primary
Antigen: SPAG5 (sperm associated antigen 5)
Clonality: monoclonal
Clone: 5F9
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG3 Kappa
Reactivity: Human



 

OBJEDNAŤ

Rozšíriť všetko / Schovať všetko
Veľkosť Pk Číslo v katalógu VWR Množstvo
100 µg 100 µG USBI133742
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

ŠPECIFIKÁCIE

Antigen symbol SPAG5
Antigen name sperm associated antigen 5
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 5F9
Host Mouse
Isotype IgG3 kappa
Western blot Yes
ELISA Yes
Purification purified by Protein A chromatography
Sequence AETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEF
Form liquid
Storage buffer PBS, pH 7,2.
Storage temperature Cool
Shipping temperature Ice
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory. Enter "x" if you don't know for VWR Chemicals.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Alebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Číslo v katalógu Availability Jednotka Vaša cena Price Per Množstvo
 

Nový vzhľad a obnovený záväzok

Postavené na funkciách a zdrojoch, ktoré poznáte, optimalizované s inováciami od spoločnosti Avantor®. Naša nová značka symbolizuje agilitu a našu schopnosť prispôsobiť sa potrebám zákazníkov.

ĎALŠIE INFORMÁCIE ZAČAŤ NAKUPOVAŤ