Keep my session open?
Ending In 
The session is expired
Vaša relácia uplynula. Pre Vašu bezpečnosť sme Vás odhlásili.
Chcete sa opäť prihlásiť?

Anti-DPPA2 Mouse Monoclonal Antibody [clone: 210CT5.14.6.1]

Dodávateľ: Abgent
Type: Primary
Antigen: DPPA2
Clonality: Monoclonal
Clone: 210CT5.14.6.1
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human



Log in to see your contract pricing and availability.
  Zapamätať si ma na tomto zariadení
 

OBJEDNAŤ

Rozšíriť všetko / Schovať všetko
Pk Číslo v katalógu VWR Množstvo
400 µl ABGEAM1915B
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

ŠPECIFIKÁCIE

Antigen symbol DPPA2
Antigen name Developmental pluripotency associated 2
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 210CT5.14.6.1
Host Mouse
Isotype IgG1 kappa
Western Blot Yes
ELISA Yes
Antigen synonyms PESCRG1, ECAT15-2, CT100
Gene ID 151871
Concentration 0.43
Immunogen This DPPA2 monoclonal antibody is generated from mouse immunized with DPPA2 recombinant protein.
Molecular Weight 33.784 kDa
Purification Protein G Purification
Sequence MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTISPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK
Storage Buffer pH 7,4
Storage temperature Maintain refrigerated at 2-8 °C for up to 6 months. For long term storage store at – 20 °C in small aliquots to prevent freeze-thaw cycles
Shipping Temperature 4 °C
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory. Enter "x" if you don't know for VWR Chemicals.

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Alebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Číslo v katalógu Availability Jednotka Vaša cena Price Per Množstvo