Keep my session open?
Ending In 
The session is expired
Vaša relácia uplynula. Pre Vašu bezpečnosť sme Vás odhlásili.
Chcete sa opäť prihlásiť?

Anti-GMFG Mouse Monoclonal Antibody

Dodávateľ: Abnova
Mouse monoclonal antibody raised against a full-length recombinant GMFG.

Type: Primary
Antigen: GMFG
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Log in to see your contract pricing and availability.
  Zapamätať si ma na tomto zariadení
 

OBJEDNAŤ

Rozšíriť všetko / Schovať všetko
Veľkosť Pk Číslo v katalógu VWR Množstvo
Up to 5 Clones 1 ABNOH00009535-M
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

ŠPECIFIKÁCIE

Antigen symbol GMFG
Antigen name Glia maturation factor, gamma
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Host Mouse
Western Blot Yes
ELISA Yes
Antigen synonyms GMF-GAMMA
Amino acid number 1 to 142
Gene ID 9535
Format Liquid
Cross Adsorption No
Immunogen GMFG (NP_004868.1, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory. Enter "x" if you don't know for VWR Chemicals.

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Alebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Číslo v katalógu Availability Jednotka Vaša cena Price Per Množstvo