Keep my session open?
Ending In 
The session is expired
Vaša relácia uplynula. Pre Vašu bezpečnosť sme Vás odhlásili.
Chcete sa opäť prihlásiť?

Anti-AMMECR1 Mouse Monoclonal Antibody

Dodávateľ: Abnova
Mouse monoclonal antibody raised against a full-length recombinant AMMECR1.

Type: Primary
Antigen: AMMECR1
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Log in to see your contract pricing and availability.
  Zapamätať si ma na tomto zariadení
 

OBJEDNAŤ

Rozšíriť všetko / Schovať všetko
Veľkosť Pk Číslo v katalógu VWR Množstvo
Up to 5 Clones 1 ABNOH00009949-M
Generate Barcodes Barcode Label Format: 
Generate PDF Catalog Page

ŠPECIFIKÁCIE

Antigen symbol AMMECR1
Antigen name Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Host Mouse
Western Blot Yes
ELISA Yes
Antigen synonyms AMMERC1
Amino acid number 1 to 296
Gene ID 9949
Format Liquid
Cross Adsorption No
Immunogen AMMECR1 (NP_001020751.1, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTLSPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS
Enter Details

Select the article for which you are looking for Certificate

Indicate the Lot Number. This field is mandatory. Enter "x" if you don't know for VWR Chemicals.

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Alebo
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Popis Číslo v katalógu Availability Jednotka Vaša cena Price Per Množstvo